Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Myosin Essential Chain [47524] (3 species) |
Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47525] (13 PDB entries) Uniprot P13543 |
Domain d1l2ob_: 1l2o B: [77660] Other proteins in same PDB: d1l2oa1, d1l2oa2, d1l2oc_ complexed with adp, ca, mg, pdm |
PDB Entry: 1l2o (more details), 2.8 Å
SCOPe Domain Sequences for d1l2ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l2ob_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea pveggkfdyvkftamikgsgee
Timeline for d1l2ob_: