Lineage for d1kx3b_ (1kx3 B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353075Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 353076Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 353077Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 353235Protein Histone H4 [47125] (4 species)
  7. 353236Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (19 PDB entries)
  8. 353239Domain d1kx3b_: 1kx3 B: [77578]
    Other proteins in same PDB: d1kx3a_, d1kx3c_, d1kx3d_, d1kx3e_, d1kx3g_, d1kx3h_

Details for d1kx3b_

PDB Entry: 1kx3 (more details), 2 Å

PDB Description: X-Ray Structure of the Nucleosome Core Particle, NCP146, at 2.0 A Resolution

SCOP Domain Sequences for d1kx3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kx3b_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis)}
vlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrkt
vtamdvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d1kx3b_:

Click to download the PDB-style file with coordinates for d1kx3b_.
(The format of our PDB-style files is described here.)

Timeline for d1kx3b_: