Lineage for d1kwka2 (1kwk A:1-393)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682153Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 682166Protein A4 beta-galactosidase [82246] (1 species)
    the catalytic domain is very similar to that of the bacterial beta-amylase; but contains a typical alpha-amylase extra domain
  7. 682167Species Thermus thermophilus [TaxId:274] [82247] (2 PDB entries)
  8. 682169Domain d1kwka2: 1kwk A:1-393 [77566]
    Other proteins in same PDB: d1kwka1, d1kwka3
    complexed with act, cl, gal, mpd, zn

Details for d1kwka2

PDB Entry: 1kwk (more details), 2.2 Å

PDB Description: crystal structure of thermus thermophilus a4 beta-galactosidase in complex with galactose
PDB Compounds: (A:) beta-galactosidase

SCOP Domain Sequences for d1kwka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwka2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]}
mlgvcyypehwpkerwkedarrmreaglshvrigefawallepepgrlewgwldeaiatl
aaeglkvvlgtptatppkwlvdrypeilpvdregrrrrfggrrhycfsspvyreearriv
tllaeryggleavagfqtdneygchdtvrcycprcqeafrgwlearygtiealneawgta
fwsqryrsfaevelphltvaepnpshlldyyrfasdqvrafnrlqveilrahapgkfvth
nfmgfftdldafalaqdldfaswdsyplgftdlmplppeeklryartghpdvaafhhdly
rgvgrgrfwvmeqqpgpvnwaphnpspapgmvrlwtwealahgaevvsyfrwrqapfaqe
qmhaglhrpdsapdqgffeakrvaeelaalalp

SCOP Domain Coordinates for d1kwka2:

Click to download the PDB-style file with coordinates for d1kwka2.
(The format of our PDB-style files is described here.)

Timeline for d1kwka2: