Lineage for d1kwka1 (1kwk A:591-644)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675781Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 675782Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 675783Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 675796Protein A4 beta-galactosidase [82181] (1 species)
    the catalytic domain of this protein is similar to that of the bacterial beta-amylase
  7. 675797Species Thermus thermophilus [TaxId:274] [82182] (2 PDB entries)
  8. 675799Domain d1kwka1: 1kwk A:591-644 [77565]
    Other proteins in same PDB: d1kwka2, d1kwka3
    complexed with act, cl, gal, mpd, zn

Details for d1kwka1

PDB Entry: 1kwk (more details), 2.2 Å

PDB Description: crystal structure of thermus thermophilus a4 beta-galactosidase in complex with galactose
PDB Compounds: (A:) beta-galactosidase

SCOP Domain Sequences for d1kwka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwka1 b.71.1.1 (A:591-644) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]}
vlslpeglrlrrrgtwvfafnygpeaveapasegarfllgsrrvgpydlavwee

SCOP Domain Coordinates for d1kwka1:

Click to download the PDB-style file with coordinates for d1kwka1.
(The format of our PDB-style files is described here.)

Timeline for d1kwka1: