SCOPe 2.02: Domain d1kmtb_: 1kmt B:

Lineage for d1kmtb_ (1kmt B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49242] (11 PDB entries)

8. Domain d1kmtb_: 1kmt B: [77443]
   mutant

Details for d1kmtb_

PDB Entry: 1kmt, 1.3 Å

PDB Description: crystal structure of rhogdi glu(154,155)ala mutant

PDB Compounds: (B:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d1kmtb_:

Sequence; same for both SEQRES and ATOM records:

>d1kmtb_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrkgvkidktdymvgsygpraaayefltpveeapkgmlargsysiksrftdd
dktdhlswewnltikkdw

Timeline for d1kmtb_:

• d1kmtb_ first appeared in SCOP 1.63
  
• d1kmtb_ appears in SCOPe 2.01
  
• d1kmtb_ appears in SCOPe 2.03
  
• d1kmtb_ appears in the current release, SCOPe 2.08, called d1kmtb1