Lineage for d1kjva2 (1kjv A:1-181)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1020887Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1021281Species Rat (Rattus norvegicus), RT1-AA [TaxId:10116] [54486] (3 PDB entries)
  8. 1021282Domain d1kjva2: 1kjv A:1-181 [77422]
    Other proteins in same PDB: d1kjva1, d1kjvb_
    complexed with so4

Details for d1kjva2

PDB Entry: 1kjv (more details), 1.48 Å

PDB Description: tap-b-associated rat mhc class i molecule
PDB Compounds: (A:) Mature alpha chain of major histocompatibility complex class I antigen (HEAVY CHAIN)

SCOPe Domain Sequences for d1kjva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjva2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Rat (Rattus norvegicus), RT1-AA [TaxId: 10116]}
gshslryfdiavsrpglgepryisvgyvddtefarydsdaenrryqprarwmeregpeyw
erntpiykgkeqtfrvnlrtlrgyynqseggshtiqemygcdvgsdgsllrgyeqfaydg
rdyialnedlktwtaadfaarisrnklerdgfadlhraylegecveslrrylelgketll
r

SCOPe Domain Coordinates for d1kjva2:

Click to download the PDB-style file with coordinates for d1kjva2.
(The format of our PDB-style files is described here.)

Timeline for d1kjva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kjva1
View in 3D
Domains from other chains:
(mouse over for more information)
d1kjvb_