Class a: All alpha proteins [46456] (286 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
Protein Growth hormone, somatotropin [47276] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47277] (9 PDB entries) |
Domain d1kf9a_: 1kf9 A: [77351] Other proteins in same PDB: d1kf9b1, d1kf9b2, d1kf9c1, d1kf9c2, d1kf9e1, d1kf9e2, d1kf9f1, d1kf9f2 phage display derived variant |
PDB Entry: 1kf9 (more details), 2.6 Å
SCOPe Domain Sequences for d1kf9a_:
Sequence, based on SEQRES records: (download)
>d1kf9a_ a.26.1.1 (A:) Growth hormone, somatotropin {Human (Homo sapiens) [TaxId: 9606]} fptiplsrladnawlradrlnqlafdtyqefeeayipkeqihsfwwnpqtslcpsesipt psnkeetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeg iqtlmgrledgsprtgqifkqtyskfdtnshnddallknygllycfnkdmskvstylrtv qcrsvegscg
>d1kf9a_ a.26.1.1 (A:) Growth hormone, somatotropin {Human (Homo sapiens) [TaxId: 9606]} fptiplsrladnawlradrlnqlafdtyqefeeayipkeqihsfwwnpqtslcpsesipt psnkeetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeg iqtlmgrlllknygllycfnkdmskvstylrtvqcrsscg
Timeline for d1kf9a_: