Lineage for d1k7qa1 (1k7q A:259-479)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1137431Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1137666Superfamily b.80.7: beta-Roll [51120] (1 family) (S)
    superhelix turns are made of two short strands each
  5. 1137667Family b.80.7.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein)
    duplication: halfturs of beta-helix are sequence and structural repeats; binds calcium ions between the turns
    this is a repeat family; one repeat unit is 1go7 P:374-356 found in domain
  6. 1137668Protein Metalloprotease [51122] (4 species)
    The catalytic N-terminal domain belong to the "zincin" superfamily
  7. 1137669Species Erwinia chrysanthemi [TaxId:556] [82189] (5 PDB entries)
    protease C
  8. 1137671Domain d1k7qa1: 1k7q A:259-479 [77283]
    Other proteins in same PDB: d1k7qa2
    complexed with ca, zn; mutant

Details for d1k7qa1

PDB Entry: 1k7q (more details), 1.8 Å

PDB Description: prtc from erwinia chrysanthemi: e189a mutant
PDB Compounds: (A:) secreted protease C

SCOPe Domain Sequences for d1k7qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k7qa1 b.80.7.1 (A:259-479) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]}
ganmttrtgdsvygfnsntdrdfytatdsskalifsvwdaggtdtfdfsgysnnqrinln
egsfsdvgglkgnvsiahgvtienaiggsgndilvgnsadnilqggagndvlyggagadt
lyggagrdtfvygsgqdstvaaydwiadfqkgidkidlsafrnegqlsfvqdqftgkgqe
vmlqwdaansitnlwlheaghssvdflvrivgqaaqsdiiv

SCOPe Domain Coordinates for d1k7qa1:

Click to download the PDB-style file with coordinates for d1k7qa1.
(The format of our PDB-style files is described here.)

Timeline for d1k7qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k7qa2