Lineage for d1ji4g_ (1ji4 G:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 212183Fold a.25: Ferritin-like [47239] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 212184Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 212185Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 212268Protein Dodecameric ferritin homolog [47250] (5 species)
  7. 212292Species Helicobacter pylori, Nap [TaxId:210] [81743] (1 PDB entry)
  8. 212299Domain d1ji4g_: 1ji4 G: [77123]

Details for d1ji4g_

PDB Entry: 1ji4 (more details), 2.52 Å

PDB Description: NAP protein from helicobacter pylori

SCOP Domain Sequences for d1ji4g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji4g_ a.25.1.1 (G:) Dodecameric ferritin homolog {Helicobacter pylori, Nap}
mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivq
lghhplvtlseaikltrvkeetktsfhskdifkeiledykylekefkelsntaekegdkv
tvtyaddqlaklqksiwmlqahla

SCOP Domain Coordinates for d1ji4g_:

Click to download the PDB-style file with coordinates for d1ji4g_.
(The format of our PDB-style files is described here.)

Timeline for d1ji4g_: