Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.41: SEA domain [82671] (1 family) automatically mapped to Pfam PF01390 |
Family d.58.41.1: SEA domain [82672] (1 protein) |
Protein SEA domain from the hypothetical protein homologous to mucin 16 [82673] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [82674] (1 PDB entry) |
Domain d1ivza1: 1ivz A:8-126 [76863] Other proteins in same PDB: d1ivza2, d1ivza3 structural genomics |
PDB Entry: 1ivz (more details)
SCOPe Domain Sequences for d1ivza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ivza1 d.58.41.1 (A:8-126) SEA domain from the hypothetical protein homologous to mucin 16 {Mouse (Mus musculus) [TaxId: 10090]} ssssqhfnlnftitnlpysqdiaqpsttkyqqtkrsienalnqlfrnssiksyfsdcqvl afrsvsnnnnhtgvdslcnfsplarrvdrvaiyeeflrmthngtqllnftldrksvfvd
Timeline for d1ivza1: