Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein Tungsten containing formate dehydrogenase, small subunit [82664] (1 species) |
Species Desulfovibrio gigas [TaxId:879] [82665] (1 PDB entry) |
Domain d1h0hl_: 1h0h L: [76440] Other proteins in same PDB: d1h0ha1, d1h0ha2, d1h0hk1, d1h0hk2 complexed with 2md, ca, epe, mgd, sf4, unx, w |
PDB Entry: 1h0h (more details), 1.8 Å
SCOPe Domain Sequences for d1h0hl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h0hl_ d.58.1.5 (L:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]} skgffvdttrctacrgcqvackqwhgnpatptentgfhqnppdfnfhtyklvrmheqeid gridwlffpdqcrhciappckatadmedesaiihddatgcvlftpktkdledyesvisac pydvprkvaesnqmakcdmcidritnglrpacvtscptgamnfgdlsemeamasarlaei kaaysdaklcdpddvrvifltahnpklyheyava
Timeline for d1h0hl_: