SCOP 1.69: Domain d1gqou_: 1gqo U:

Lineage for d1gqou_ (1gqo U:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family)

5. Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein)

6. Protein Type II 3-dehydroquinate dehydratase [52306] (5 species)

7. Species Bacillus subtilis [TaxId:1423] [82349] (1 PDB entry)

8. Domain d1gqou_: 1gqo U: [76315]

Details for d1gqou_

PDB Entry: 1gqo, 2.1 Å

PDB Description: type ii dehydroquinase from bacillus subtilis

SCOP Domain Sequences for d1gqou_:

Sequence; same for both SEQRES and ATOM records:

>d1gqou_ c.23.13.1 (U:) Type II 3-dehydroquinate dehydratase {Bacillus subtilis}
phflilngpnvnrlgsrepevfgrqtltdietdlfqfaealhiqltffqsnhegdlidai
heaeeqysgivlnpgalshysyairdavssislpvvevhlsnlyareefrhqsviapvak
gqivglgaegyklavryllsq

Timeline for d1gqou_:

• d1gqou_ first appeared in SCOP 1.63
  
• d1gqou_ appears in SCOP 1.67
  
• d1gqou_ appears in SCOP 1.71
  
• d1gqou_ appears in the current release, SCOPe 2.08