SCOP 1.69: Domain d1gqoq_: 1gqo Q:

Lineage for d1gqoq_ (1gqo Q:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family)

5. Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein)

6. Protein Type II 3-dehydroquinate dehydratase [52306] (5 species)

7. Species Bacillus subtilis [TaxId:1423] [82349] (1 PDB entry)

8. Domain d1gqoq_: 1gqo Q: [76311]

Details for d1gqoq_

PDB Entry: 1gqo, 2.1 Å

PDB Description: type ii dehydroquinase from bacillus subtilis

SCOP Domain Sequences for d1gqoq_:

Sequence; same for both SEQRES and ATOM records:

>d1gqoq_ c.23.13.1 (Q:) Type II 3-dehydroquinate dehydratase {Bacillus subtilis}
phflilngpnvnrlgsrepevfgrqtltdietdlfqfaealhiqltffqsnhegdlidai
heaeeqysgivlnpgalshysyairdavssislpvvevhlsnlyareefrhqsviapvak
gqivglgaegyklavryllsq

Timeline for d1gqoq_:

• d1gqoq_ first appeared in SCOP 1.63
  
• d1gqoq_ appears in SCOP 1.67
  
• d1gqoq_ appears in SCOP 1.71
  
• d1gqoq_ appears in the current release, SCOPe 2.08