Lineage for d1gqob_ (1gqo B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481748Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family) (S)
  5. 481749Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein)
  6. 481750Protein Type II 3-dehydroquinate dehydratase [52306] (5 species)
  7. 481764Species Bacillus subtilis [TaxId:1423] [82349] (1 PDB entry)
  8. 481766Domain d1gqob_: 1gqo B: [76296]

Details for d1gqob_

PDB Entry: 1gqo (more details), 2.1 Å

PDB Description: type ii dehydroquinase from bacillus subtilis

SCOP Domain Sequences for d1gqob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqob_ c.23.13.1 (B:) Type II 3-dehydroquinate dehydratase {Bacillus subtilis}
phflilngpnvnrlgsrepevfgrqtltdietdlfqfaealhiqltffqsnhegdlidai
heaeeqysgivlnpgalshysyairdavssislpvvevhlsnlyareefrhqsviapvak
gqivglgaegyklavryllsqqg

SCOP Domain Coordinates for d1gqob_:

Click to download the PDB-style file with coordinates for d1gqob_.
(The format of our PDB-style files is described here.)

Timeline for d1gqob_: