Lineage for d1epvb2 (1epv B:12-244)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384215Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 384216Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)
  6. 384217Protein Alanine racemase [51421] (1 species)
  7. 384218Species Bacillus stearothermophilus [TaxId:1422] [51422] (8 PDB entries)
  8. 384234Domain d1epvb2: 1epv B:12-244 [76149]
    Other proteins in same PDB: d1epva1, d1epvb1
    complexed with kcx, scp

Details for d1epvb2

PDB Entry: 1epv (more details), 2.2 Å

PDB Description: alanine racemase with bound inhibitor derived from d-cycloserine

SCOP Domain Sequences for d1epvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1epvb2 c.1.6.1 (B:12-244) Alanine racemase {Bacillus stearothermophilus}
vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal
alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd
tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew
lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea

SCOP Domain Coordinates for d1epvb2:

Click to download the PDB-style file with coordinates for d1epvb2.
(The format of our PDB-style files is described here.)

Timeline for d1epvb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1epvb1