![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins) topological similarity to the N-terminal domain |
![]() | Protein DNA polymerase beta [81579] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [81575] (107 PDB entries) |
![]() | Domain d8icna3: 8icn A:92-148 [76060] Other proteins in same PDB: d8icna1, d8icna4 protein/DNA complex; complexed with atp, mn, na |
PDB Entry: 8icn (more details), 2.8 Å
SCOPe Domain Sequences for d8icna3:
Sequence; same for both SEQRES and ATOM records: (download)
>d8icna3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]} dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek
Timeline for d8icna3: