Lineage for d1ma0b2 (1ma0 B:163-338)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2102559Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
    N-terminal all-beta domain defines family
  6. 2102580Protein Alcohol dehydrogenase [51737] (9 species)
  7. 2102697Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (24 PDB entries)
    Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327
  8. 2102719Domain d1ma0b2: 1ma0 B:163-338 [74608]
    Other proteins in same PDB: d1ma0a1, d1ma0b1
    glutathione-dependent formaldehyde dehydrogenase
    complexed with dao, k, nad, po4, zn

Details for d1ma0b2

PDB Entry: 1ma0 (more details), 2.3 Å

PDB Description: Ternary complex of Human glutathione-dependent formaldehyde dehydrogenase with NAD+ and dodecanoic acid
PDB Compounds: (B:) Glutathione-dependent formaldehyde dehydrogenase

SCOPe Domain Sequences for d1ma0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ma0b2 c.2.1.1 (B:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
apldkvcllgcgistgygaavntaklepgsvcavfglggvglavimgckvagasriigvd
inkdkfarakefgatecinpqdfskpiqevliemtdggvdysfecignvkvmraaleach
kgwgvsvvvgvaasgeeiatrpfqlvtgrtwkgtafggwksvesvpklvseymskk

SCOPe Domain Coordinates for d1ma0b2:

Click to download the PDB-style file with coordinates for d1ma0b2.
(The format of our PDB-style files is described here.)

Timeline for d1ma0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ma0b1