Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Elastase [50536] (4 species) |
Species Worm (Eisenia fetida) [TaxId:6396] [74973] (1 PDB entry) fibrinolytic enzyme component A |
Domain d1m9ua_: 1m9u A: [74601] |
PDB Entry: 1m9u (more details), 2.3 Å
SCOPe Domain Sequences for d1m9ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} viggtnaspgefpwqlsqqrqsgswshscgasllsstsalsashcvdgvlpnnirviagl wqqsdtsgtqtanvdsytmhenygagtasysndiailhlatsislggniqaavlpannnn dyagttcvisgwgrtdgtnnlpdilqkssipvittaqctaamvgvgganiwdnhicvqdp agntgacngdsggplncpdggtrvvgvtswvvssglgaclpdypsvytrvsaylgwigdn s
Timeline for d1m9ua_: