![]() | Class g: Small proteins [56992] (66 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies) disulphide-bound fold; contains beta-hairpin with two adjacent disulphides |
![]() | Superfamily g.3.9: Growth factor receptor domain [57184] (1 family) ![]() |
![]() | Family g.3.9.1: Growth factor receptor domain [57185] (5 proteins) |
![]() | Protein Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains [75668] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75669] (1 PDB entry) |
![]() | Domain d1m6bb4: 1m6b B:480-611 [74528] Other proteins in same PDB: d1m6ba1, d1m6ba2, d1m6bb1, d1m6bb2 complexed with nag, so4 |
PDB Entry: 1m6b (more details), 2.6 Å
SCOP Domain Sequences for d1m6bb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m6bb4 g.3.9.1 (B:480-611) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens)} vcdplcssggcwgpgpgqclscrnysrggvcvthcnflngeprefaheaecfschpecqp megtatcngsgsdtcaqcahfrdgphcvsscphgvlgakgpiykypdvqnecrpchenct qgckgpelqdcl
Timeline for d1m6bb4:
![]() Domains from other chains: (mouse over for more information) d1m6ba1, d1m6ba2, d1m6ba3, d1m6ba4 |