Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) |
Family g.3.9.1: Growth factor receptor domain [57185] (11 proteins) Pfam PF00757; Pfam PF14843; Pfam PF15913 heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures |
Protein Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains [75668] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75669] (1 PDB entry) |
Domain d1m6bb4: 1m6b B:480-611 [74528] Other proteins in same PDB: d1m6ba1, d1m6ba2, d1m6bb1, d1m6bb2 complexed with nag, so4 |
PDB Entry: 1m6b (more details), 2.6 Å
SCOPe Domain Sequences for d1m6bb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m6bb4 g.3.9.1 (B:480-611) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} vcdplcssggcwgpgpgqclscrnysrggvcvthcnflngeprefaheaecfschpecqp megtatcngsgsdtcaqcahfrdgphcvsscphgvlgakgpiykypdvqnecrpchenct qgckgpelqdcl
Timeline for d1m6bb4:
View in 3D Domains from other chains: (mouse over for more information) d1m6ba1, d1m6ba2, d1m6ba3, d1m6ba4 |