Lineage for d1m5kc_ (1m5k C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1652149Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1652150Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1652456Protein Splicesomal U1A protein [54932] (2 species)
    duplication: contains two domains of this fold
  7. 1652461Species Human (Homo sapiens) [TaxId:9606] [54933] (43 PDB entries)
    Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98
  8. 1652477Domain d1m5kc_: 1m5k C: [74509]
    domain 1, complex with a hairpin ribozyme
    protein/RNA complex; complexed with ca, cl

Details for d1m5kc_

PDB Entry: 1m5k (more details), 2.4 Å

PDB Description: crystal structure of a hairpin ribozyme in the catalytically-active conformation
PDB Compounds: (C:) protein (u1 small nuclear ribonucleoprotein a)

SCOPe Domain Sequences for d1m5kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5kc_ d.58.7.1 (C:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmriqyaktdsdiiakm

SCOPe Domain Coordinates for d1m5kc_:

Click to download the PDB-style file with coordinates for d1m5kc_.
(The format of our PDB-style files is described here.)

Timeline for d1m5kc_: