Lineage for d1m1xb2 (1m1x B:107-354)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999157Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 999158Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 999159Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 999213Protein Integrin beta A domain [69542] (1 species)
  7. 999214Species Human (Homo sapiens) [TaxId:9606] [69543] (5 PDB entries)
    Uniprot P05106 27-716 ! Uniprot P05106 27-466
  8. 999218Domain d1m1xb2: 1m1x B:107-354 [74427]
    Other proteins in same PDB: d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4, d1m1xb1, d1m1xb3, d1m1xb4, d1m1xb5
    complexed with mn, nag

Details for d1m1xb2

PDB Entry: 1m1x (more details), 3.3 Å

PDB Description: crystal structure of the extracellular segment of integrin alpha vbeta3 bound to mn2+
PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1m1xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1xb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]}
vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy
isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai
mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt
mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd
aygkirsk

SCOPe Domain Coordinates for d1m1xb2:

Click to download the PDB-style file with coordinates for d1m1xb2.
(The format of our PDB-style files is described here.)

Timeline for d1m1xb2: