Lineage for d1lqsr1 (1lqs R:2-100)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2372014Protein Interleukin-10 receptor 1, IL-10R1 [63670] (1 species)
  7. 2372015Species Human (Homo sapiens) [TaxId:9606] [63671] (5 PDB entries)
  8. 2372024Domain d1lqsr1: 1lqs R:2-100 [74194]
    Other proteins in same PDB: d1lqsl_, d1lqsm_
    complexed with human cytomegalovirus IL-10
    complexed with nag

Details for d1lqsr1

PDB Entry: 1lqs (more details), 2.7 Å

PDB Description: crystal structure of human cytomegalovirus il-10 bound to soluble human il-10r1
PDB Compounds: (R:) interleukin-10 receptor alpha chain

SCOPe Domain Sequences for d1lqsr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqsr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]}
gtelpsppsvwfeaeffhhilhwtpipqqsestcyevallrygieswnsisqcsqtlsyd
ltavtldlyhsngyrarvravdgsrhsqwtvtntrfsvd

SCOPe Domain Coordinates for d1lqsr1:

Click to download the PDB-style file with coordinates for d1lqsr1.
(The format of our PDB-style files is described here.)

Timeline for d1lqsr1: