Lineage for d1lo0h1 (1lo0 H:1-119)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 220171Species Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain [74810] (4 PDB entries)
  8. 220172Domain d1lo0h1: 1lo0 H:1-119 [74115]
    Other proteins in same PDB: d1lo0h2, d1lo0l2, d1lo0x2, d1lo0y2
    complexed with bc1

Details for d1lo0h1

PDB Entry: 1lo0 (more details), 2 Å

PDB Description: Catalytic Retro-Diels-Alderase Transition State Analogue Complex
PDB Compounds: (H:)

SCOP Domain Sequences for d1lo0h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo0h1 b.1.1.1 (H:1-119) Immunoglobulin (variable domains of L and H chains) {Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain}
evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp
dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsa

SCOP Domain Coordinates for d1lo0h1:

Click to download the PDB-style file with coordinates for d1lo0h1.
(The format of our PDB-style files is described here.)

Timeline for d1lo0h1: