![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
![]() | Species Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain [74810] (4 PDB entries) |
![]() | Domain d1lo0h1: 1lo0 H:1-119 [74115] Other proteins in same PDB: d1lo0h2, d1lo0l2, d1lo0x2, d1lo0y2 |
PDB Entry: 1lo0 (more details), 2 Å
SCOP Domain Sequences for d1lo0h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lo0h1 b.1.1.1 (H:1-119) Immunoglobulin (variable domains of L and H chains) {Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain} evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsa
Timeline for d1lo0h1: