![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.4: Biliverdin reductase [55373] (1 protein) |
![]() | Protein Biliverdin reductase [55374] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [55375] (3 PDB entries) |
![]() | Domain d1lc3a2: 1lc3 A:129-246 [73826] Other proteins in same PDB: d1lc3a1 complexed with nad, po4 |
PDB Entry: 1lc3 (more details), 1.5 Å
SCOPe Domain Sequences for d1lc3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lc3a2 d.81.1.4 (A:129-246) Biliverdin reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]} meefeflrrevlgkellkgslrftaspleeerfgfpafsgisrltwlvslfgelslisat leerkedqymkmtvqletqnkgllswieekgpglkrnryvnfqftsgsleevpsvgvn
Timeline for d1lc3a2: