Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.6: Integrin beta EGF-like domains [69940] (1 protein) |
Protein Integrin beta EGF-like domains [69941] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69942] (5 PDB entries) Uniprot P05106 27-716 |
Domain d1l5gb5: 1l5g B:563-605 [73589] Other proteins in same PDB: d1l5ga1, d1l5ga2, d1l5ga3, d1l5ga4, d1l5gb1, d1l5gb2, d1l5gb3 complexed with mn, mva, nag |
PDB Entry: 1l5g (more details), 3.2 Å
SCOP Domain Sequences for d1l5gb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l5gb5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} rtdtcmssngllcsgrgkcecgscvciqpgsygdtcekcptcp
Timeline for d1l5gb5:
View in 3D Domains from same chain: (mouse over for more information) d1l5gb1, d1l5gb2, d1l5gb3, d1l5gb4 |
View in 3D Domains from other chains: (mouse over for more information) d1l5ga1, d1l5ga2, d1l5ga3, d1l5ga4 |