Lineage for d1l5gb5 (1l5g B:563-605)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889622Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 890053Family g.3.11.6: Integrin beta EGF-like domains [69940] (1 protein)
  6. 890054Protein Integrin beta EGF-like domains [69941] (1 species)
  7. 890055Species Human (Homo sapiens) [TaxId:9606] [69942] (5 PDB entries)
    Uniprot P05106 27-716
  8. 890059Domain d1l5gb5: 1l5g B:563-605 [73589]
    Other proteins in same PDB: d1l5ga1, d1l5ga2, d1l5ga3, d1l5ga4, d1l5gb1, d1l5gb2, d1l5gb3
    complexed with mn, mva, nag

Details for d1l5gb5

PDB Entry: 1l5g (more details), 3.2 Å

PDB Description: crystal structure of the extracellular segment of integrin avb3 in complex with an arg-gly-asp ligand
PDB Compounds: (B:) integrin beta-3

SCOP Domain Sequences for d1l5gb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5gb5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}
rtdtcmssngllcsgrgkcecgscvciqpgsygdtcekcptcp

SCOP Domain Coordinates for d1l5gb5:

Click to download the PDB-style file with coordinates for d1l5gb5.
(The format of our PDB-style files is described here.)

Timeline for d1l5gb5: