Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (5 families) |
Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins) |
Protein Integrin beta A domain [69542] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69543] (5 PDB entries) Uniprot P05106 27-716 Uniprot P05106 27-466 Uniprot P05106 27-716 ! Uniprot P05106 27-466 |
Domain d1l5gb2: 1l5g B:107-354 [73586] Other proteins in same PDB: d1l5ga1, d1l5ga2, d1l5ga3, d1l5ga4, d1l5gb1, d1l5gb3, d1l5gb4, d1l5gb5 complexed with mn, mva, nag |
PDB Entry: 1l5g (more details), 3.2 Å
SCOP Domain Sequences for d1l5gb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l5gb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]} vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd aygkirsk
Timeline for d1l5gb2:
View in 3D Domains from same chain: (mouse over for more information) d1l5gb1, d1l5gb3, d1l5gb4, d1l5gb5 |
View in 3D Domains from other chains: (mouse over for more information) d1l5ga1, d1l5ga2, d1l5ga3, d1l5ga4 |