Lineage for d1l5gb2 (1l5g B:107-354)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 318167Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 318168Superfamily c.62.1: vWA-like [53300] (2 families) (S)
  5. 318169Family c.62.1.1: Integrin A (or I) domain [53301] (8 proteins)
  6. 318201Protein Integrin beta A domain [69542] (1 species)
  7. 318202Species Human (Homo sapiens) [TaxId:9606] [69543] (3 PDB entries)
  8. 318205Domain d1l5gb2: 1l5g B:107-354 [73586]
    Other proteins in same PDB: d1l5ga1, d1l5ga2, d1l5ga3, d1l5ga4, d1l5gb1, d1l5gb3, d1l5gb4, d1l5gb5
    complexed with mn, mva, nag

Details for d1l5gb2

PDB Entry: 1l5g (more details), 3.2 Å

PDB Description: crystal structure of the extracellular segment of integrin avb3 in complex with an arg-gly-asp ligand

SCOP Domain Sequences for d1l5gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5gb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens)}
vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy
isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai
mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt
mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd
aygkirsk

SCOP Domain Coordinates for d1l5gb2:

Click to download the PDB-style file with coordinates for d1l5gb2.
(The format of our PDB-style files is described here.)

Timeline for d1l5gb2: