Lineage for d1l4ua_ (1l4u A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987470Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
  6. 987471Protein Shikimate kinase (AroK) [52567] (4 species)
  7. 987485Species Mycobacterium tuberculosis [TaxId:1773] [75194] (10 PDB entries)
    Uniprot P95014
  8. 987487Domain d1l4ua_: 1l4u A: [73568]
    complexed with adp, cl, epe, mg, pt

Details for d1l4ua_

PDB Entry: 1l4u (more details), 1.8 Å

PDB Description: crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with mgadp and pt(ii) at 1.8 angstrom resolution
PDB Compounds: (A:) Shikimate kinase

SCOPe Domain Sequences for d1l4ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l4ua_ c.37.1.2 (A:) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrl

SCOPe Domain Coordinates for d1l4ua_:

Click to download the PDB-style file with coordinates for d1l4ua_.
(The format of our PDB-style files is described here.)

Timeline for d1l4ua_: