![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.110: Profilin-like [55769] (5 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.5: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors [75516] (1 family) ![]() |
![]() | Family d.110.5.1: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors [75517] (1 protein) |
![]() | Protein Transcription factor TraR, N-terminal domain [75518] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [75519] (2 PDB entries) |
![]() | Domain d1l3lc2: 1l3l C:1-162 [73546] Other proteins in same PDB: d1l3la1, d1l3lb1, d1l3lc1, d1l3ld1 |
PDB Entry: 1l3l (more details), 1.66 Å
SCOP Domain Sequences for d1l3lc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l3lc2 d.110.5.1 (C:1-162) Transcription factor TraR, N-terminal domain {Agrobacterium tumefaciens} mqhwldkltdlaaiegdecilktgladiadhfgftgyaylhiqhrhitavtnyhrqwqst yfdkkfealdpvvkrarsrkhiftwsgeherptlskderafydhasdfgirsgitipikt angfmsmftmasdkpvidldreidavaaaatigqiharisfl
Timeline for d1l3lc2: