Lineage for d1l3lc2 (1l3l C:1-162)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261219Fold d.110: Profilin-like [55769] (5 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 261350Superfamily d.110.5: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors [75516] (1 family) (S)
  5. 261351Family d.110.5.1: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors [75517] (1 protein)
  6. 261352Protein Transcription factor TraR, N-terminal domain [75518] (1 species)
  7. 261353Species Agrobacterium tumefaciens [TaxId:358] [75519] (2 PDB entries)
  8. 261356Domain d1l3lc2: 1l3l C:1-162 [73546]
    Other proteins in same PDB: d1l3la1, d1l3lb1, d1l3lc1, d1l3ld1

Details for d1l3lc2

PDB Entry: 1l3l (more details), 1.66 Å

PDB Description: crystal structure of a bacterial quorum-sensing transcription factor complexed with pheromone and dna

SCOP Domain Sequences for d1l3lc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3lc2 d.110.5.1 (C:1-162) Transcription factor TraR, N-terminal domain {Agrobacterium tumefaciens}
mqhwldkltdlaaiegdecilktgladiadhfgftgyaylhiqhrhitavtnyhrqwqst
yfdkkfealdpvvkrarsrkhiftwsgeherptlskderafydhasdfgirsgitipikt
angfmsmftmasdkpvidldreidavaaaatigqiharisfl

SCOP Domain Coordinates for d1l3lc2:

Click to download the PDB-style file with coordinates for d1l3lc2.
(The format of our PDB-style files is described here.)

Timeline for d1l3lc2: