Lineage for d1l3lb1 (1l3l B:170-234)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 278295Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 278314Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (4 proteins)
    contains additional, fourth helix in the C-terminal extension
  6. 278332Protein Quorum-sensing transcription factor TraR, C-terminal domain [74690] (1 species)
  7. 278333Species Agrobacterium tumefaciens [TaxId:358] [74691] (2 PDB entries)
  8. 278335Domain d1l3lb1: 1l3l B:170-234 [73543]
    Other proteins in same PDB: d1l3la2, d1l3lb2, d1l3lc2, d1l3ld2

Details for d1l3lb1

PDB Entry: 1l3l (more details), 1.66 Å

PDB Description: crystal structure of a bacterial quorum-sensing transcription factor complexed with pheromone and dna

SCOP Domain Sequences for d1l3lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3lb1 a.4.6.2 (B:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens}
daawldpkeatylrwiavgktmeeiadvegvkynsvrvklreamkrfdvrskahltalai
rrkli

SCOP Domain Coordinates for d1l3lb1:

Click to download the PDB-style file with coordinates for d1l3lb1.
(The format of our PDB-style files is described here.)

Timeline for d1l3lb1: