Lineage for d1l3ka1 (1l3k A:8-91)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027962Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1027963Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1028086Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species)
    duplication: contains two domains of this fold
  7. 1028087Species Human (Homo sapiens) [TaxId:9606] [54931] (14 PDB entries)
    Uniprot P09651 7-188
  8. 1028088Domain d1l3ka1: 1l3k A:8-91 [73539]

Details for d1l3ka1

PDB Entry: 1l3k (more details), 1.1 Å

PDB Description: up1, the two rna-recognition motif domain of hnrnp a1
PDB Compounds: (A:) heterogeneous nuclear ribonucleoprotein a1

SCOPe Domain Sequences for d1l3ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}
kepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatvee
vdaamnarphkvdgrvvepkravs

SCOPe Domain Coordinates for d1l3ka1:

Click to download the PDB-style file with coordinates for d1l3ka1.
(The format of our PDB-style files is described here.)

Timeline for d1l3ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l3ka2