Lineage for d1l1oa_ (1l1o A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 950107Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 950174Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 950236Protein Replication protein A 14 KDa (RPA14) subunit [50271] (1 species)
  7. 950237Species Human (Homo sapiens) [TaxId:9606] [50272] (5 PDB entries)
  8. 950248Domain d1l1oa_: 1l1o A: [73478]
    Other proteins in same PDB: d1l1ob_, d1l1oc_, d1l1oe_, d1l1of_
    complexed with zn

Details for d1l1oa_

PDB Entry: 1l1o (more details), 2.8 Å

PDB Description: Structure of the human Replication Protein A (RPA) trimerization core
PDB Compounds: (A:) Replication protein A 14 kDa subunit

SCOPe Domain Sequences for d1l1oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1oa_ b.40.4.3 (A:) Replication protein A 14 KDa (RPA14) subunit {Human (Homo sapiens) [TaxId: 9606]}
dmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmepldee
isgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplgi

SCOPe Domain Coordinates for d1l1oa_:

Click to download the PDB-style file with coordinates for d1l1oa_.
(The format of our PDB-style files is described here.)

Timeline for d1l1oa_: