Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.11: Siroheme synthase N-terminal domain-like [75110] (2 proteins) |
Protein Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain [75111] (1 species) involved in siroheme synthesis |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75112] (1 PDB entry) |
Domain d1kyqb1: 1kyq B:1-150 [73283] Other proteins in same PDB: d1kyqa2, d1kyqb2, d1kyqc2 complexed with nad |
PDB Entry: 1kyq (more details), 2.2 Å
SCOPe Domain Sequences for d1kyqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyqb1 c.2.1.11 (B:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mvkslqlahqlkdkrilligggevgltrlyklmptgckltlvspdlhksiipkfgkfiqn kdqpdyredakrfinpnwdptkneiyeyirsdfkdeyldlenendawyiimtcipdhpes ariyhlckerfgkqqlvnvadkpdlcdfyf
Timeline for d1kyqb1:
View in 3D Domains from other chains: (mouse over for more information) d1kyqa1, d1kyqa2, d1kyqc1, d1kyqc2 |