Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
Protein HslV (ClpQ) protease [56258] (3 species) dodecameric prokaryotic homologue of proteasome |
Species Haemophilus influenzae [TaxId:727] [56260] (6 PDB entries) |
Domain d1kyij_: 1kyi J: [73232] Other proteins in same PDB: d1kyia_, d1kyib_, d1kyic_, d1kyid_, d1kyie_, d1kyif_, d1kyis_, d1kyit_, d1kyiu_, d1kyiv_, d1kyiw_, d1kyix_ |
PDB Entry: 1kyi (more details), 3.1 Å
SCOP Domain Sequences for d1kyij_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyij_ d.153.1.4 (J:) HslV (ClpQ) protease {Haemophilus influenzae} ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
Timeline for d1kyij_: