Lineage for d1kyij_ (1kyi J:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 335536Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 335537Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 335658Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 335659Protein HslV (ClpQ) protease [56258] (3 species)
    dodecameric prokaryotic homologue of proteasome
  7. 335696Species Haemophilus influenzae [TaxId:727] [56260] (6 PDB entries)
  8. 335718Domain d1kyij_: 1kyi J: [73232]
    Other proteins in same PDB: d1kyia_, d1kyib_, d1kyic_, d1kyid_, d1kyie_, d1kyif_, d1kyis_, d1kyit_, d1kyiu_, d1kyiv_, d1kyiw_, d1kyix_

Details for d1kyij_

PDB Entry: 1kyi (more details), 3.1 Å

PDB Description: HslUV (H. influenzae)-NLVS Vinyl Sulfone Inhibitor Complex

SCOP Domain Sequences for d1kyij_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyij_ d.153.1.4 (J:) HslV (ClpQ) protease {Haemophilus influenzae}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp

SCOP Domain Coordinates for d1kyij_:

Click to download the PDB-style file with coordinates for d1kyij_.
(The format of our PDB-style files is described here.)

Timeline for d1kyij_: