Lineage for d1ky9a1 (1ky9 A:260-353)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1122537Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1122538Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1122931Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)
  6. 1122937Protein Protease Do (DegP, HtrA), C-terminal domains [74934] (1 species)
    duplication: tandem repeat of two PDZ domains
  7. 1122938Species Escherichia coli [TaxId:562] [74935] (3 PDB entries)
  8. 1122941Domain d1ky9a1: 1ky9 A:260-353 [73198]
    Other proteins in same PDB: d1ky9a2, d1ky9b3

Details for d1ky9a1

PDB Entry: 1ky9 (more details), 2.8 Å

PDB Description: crystal structure of degp (htra)
PDB Compounds: (A:) Protease do

SCOPe Domain Sequences for d1ky9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]}
vkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaakagikagdvitslngkpis
sfaalraqvgtmpvgskltlgllrdgkqvnvnle

SCOPe Domain Coordinates for d1ky9a1:

Click to download the PDB-style file with coordinates for d1ky9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ky9a1: