SCOPe 2.03: Domain d1ktdd1: 1ktd D:121-215

Lineage for d1ktdd1 (1ktd D:121-215)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (9 PDB entries)
   probably orthologous to the human HLA-DR group

8. Domain d1ktdd1: 1ktd D:121-215 [72970]
   Other proteins in same PDB: d1ktda1, d1ktda2, d1ktdb2, d1ktdc1, d1ktdc2, d1ktdd2
   contains covalently bound peptides at the N-termini of chains B and D
   complexed with nag, so4

Details for d1ktdd1

PDB Entry: 1ktd, 2.4 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to pigeon cytochrome c peptide

PDB Compounds: (D:) Fusion protein consisting of cytochrome C peptide, glycine rich linker, and MHC E-beta-k

SCOPe Domain Sequences for d1ktdd1:

Sequence; same for both SEQRES and ATOM records:

>d1ktdd1 b.1.1.2 (D:121-215) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
rveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdw
tfqtlvmletvpqsgevytcqvehpsltdpvtvew

Timeline for d1ktdd1:

• d1ktdd1 first appeared in SCOP 1.61
  
• d1ktdd1 appears in SCOPe 2.02
  
• d1ktdd1 appears in SCOPe 2.04
  
• d1ktdd1 appears in the current release, SCOPe 2.08