Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.35: Pseudouridine synthase [55120] (3 families) duplication: contains two subdomains of this fold |
Family d.58.35.3: Ribosomal small subunit pseudouridine 516 synthase RsuA [75459] (1 protein) contains N-terminal alpha-L RNA-binding motif |
Protein Ribosomal small subunit pseudouridine 516 synthase RsuA [75460] (1 species) |
Species Escherichia coli [TaxId:562] [75461] (3 PDB entries) |
Domain d1ksla1: 1ksl A:60-124 [72921] Other proteins in same PDB: d1ksla3 |
PDB Entry: 1ksl (more details), 2.1 Å
SCOP Domain Sequences for d1ksla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ksla1 d.58.35.3 (A:60-124) Ribosomal small subunit pseudouridine 516 synthase RsuA {Escherichia coli} pryfmlnkpqgyvcstddpdhptvlyfldepvawklhaagrldidttglvlmtddgqwsh ritsp
Timeline for d1ksla1: