Lineage for d1klfg2 (1klf G:122-205)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 224988Fold b.7: C2 domain-like [49561] (4 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 225058Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) (S)
  5. 225059Family b.7.2.1: Periplasmic chaperone C-domain [49585] (3 proteins)
  6. 225060Protein FimC [49588] (1 species)
  7. 225061Species Escherichia coli [TaxId:562] [49589] (4 PDB entries)
  8. 225065Domain d1klfg2: 1klf G:122-205 [72695]
    Other proteins in same PDB: d1klfa1, d1klfb1, d1klfb2, d1klfc1, d1klfd1, d1klfd2, d1klfe1, d1klff1, d1klff2, d1klfg1, d1klfh1, d1klfh2, d1klfi1, d1klfj1, d1klfj2, d1klfk1, d1klfl1, d1klfl2, d1klfm1, d1klfn1, d1klfn2, d1klfo1, d1klfp1, d1klfp2

Details for d1klfg2

PDB Entry: 1klf (more details), 2.79 Å

PDB Description: fimh adhesin-fimc chaperone complex with d-mannose

SCOP Domain Sequences for d1klfg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klfg2 b.7.2.1 (G:122-205) FimC {Escherichia coli}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme

SCOP Domain Coordinates for d1klfg2:

Click to download the PDB-style file with coordinates for d1klfg2.
(The format of our PDB-style files is described here.)

Timeline for d1klfg2:

225065
d1klfg2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1klfg1