Lineage for d1kiub2 (1kiu B:159-279)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1771869Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1771874Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1771891Protein Mannose-specific adhesin FimH [49406] (2 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 1771892Species Escherichia coli [TaxId:562] [49407] (23 PDB entries)
  8. 1771962Domain d1kiub2: 1kiu B:159-279 [72526]
    Other proteins in same PDB: d1kiua1, d1kiua2, d1kiuc1, d1kiuc2, d1kiue1, d1kiue2, d1kiug1, d1kiug2, d1kiui1, d1kiui2, d1kiuk1, d1kiuk2, d1kium1, d1kium2, d1kiuo1, d1kiuo2
    complexed with mma; mutant

Details for d1kiub2

PDB Entry: 1kiu (more details), 3 Å

PDB Description: fimh adhesin q133n mutant-fimc chaperone complex with methyl-alpha-d- mannose
PDB Compounds: (B:) FimH PROTEIN

SCOPe Domain Sequences for d1kiub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kiub2 b.2.3.2 (B:159-279) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

SCOPe Domain Coordinates for d1kiub2:

Click to download the PDB-style file with coordinates for d1kiub2.
(The format of our PDB-style files is described here.)

Timeline for d1kiub2: