Lineage for d1kfym1 (1kfy M:443-576)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211240Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 211274Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 211275Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 211282Protein Fumarate reductase [46981] (2 species)
  7. 211283Species Escherichia coli [TaxId:562] [46982] (3 PDB entries)
  8. 211289Domain d1kfym1: 1kfy M:443-576 [72434]
    Other proteins in same PDB: d1kfya2, d1kfya3, d1kfyb1, d1kfyb2, d1kfyc_, d1kfyd_, d1kfym2, d1kfym3, d1kfyn1, d1kfyn2, d1kfyo_, d1kfyp_
    complexed with brs, ce1, f3s, fad, fes, fs4, oaa

Details for d1kfym1

PDB Entry: 1kfy (more details), 3.6 Å

PDB Description: quinol-fumarate reductase with quinol inhibitor 2-[1-(4-chloro-phenyl)-ethyl]-4,6-dinitro-phenol

SCOP Domain Sequences for d1kfym1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfym1 a.7.3.1 (M:443-576) Fumarate reductase {Escherichia coli}
dggenwakirdemglameegcgiyrtpelmqktidklaelqerfkrvritdtssvfntdl
lytielghglnvaecmahsamarkesrgahqrldegcterddvnflkhtlafrdadgttr
leysdvkittlppa

SCOP Domain Coordinates for d1kfym1:

Click to download the PDB-style file with coordinates for d1kfym1.
(The format of our PDB-style files is described here.)

Timeline for d1kfym1: