Lineage for d1kfyp_ (1kfy P:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 267974Fold f.21: Heme-binding four-helical bundle [81344] (2 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 267997Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 268009Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (4 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 268018Protein Fumarate reductase subunit FrdD [81372] (1 species)
  7. 268019Species Escherichia coli [TaxId:562] [81371] (3 PDB entries)
    is not known to bind heme
  8. 268025Domain d1kfyp_: 1kfy P: [72440]
    Other proteins in same PDB: d1kfya1, d1kfya2, d1kfya3, d1kfyb1, d1kfyb2, d1kfyc_, d1kfym1, d1kfym2, d1kfym3, d1kfyn1, d1kfyn2, d1kfyo_
    complexed with brs, ce1, f3s, fad, fes, fs4, oaa

Details for d1kfyp_

PDB Entry: 1kfy (more details), 3.6 Å

PDB Description: quinol-fumarate reductase with quinol inhibitor 2-[1-(4-chloro-phenyl)-ethyl]-4,6-dinitro-phenol

SCOP Domain Sequences for d1kfyp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfyp_ f.21.2.2 (P:) Fumarate reductase subunit FrdD {Escherichia coli}
minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq
sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti

SCOP Domain Coordinates for d1kfyp_:

Click to download the PDB-style file with coordinates for d1kfyp_.
(The format of our PDB-style files is described here.)

Timeline for d1kfyp_: