Lineage for d1kd14_ (1kd1 4:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263551Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 2263656Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
    automatically mapped to Pfam PF00935
  6. 2263657Protein Ribosomal protein L44e [57837] (1 species)
  7. 2263658Species Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
    Uniprot P32411
  8. 2263693Domain d1kd14_: 1kd1 4: [72322]
    Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_
    complexed with cd, cl, k, mg, na, spr

Details for d1kd14_

PDB Entry: 1kd1 (more details), 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui
PDB Compounds: (4:) ribosomal protein l44e

SCOPe Domain Sequences for d1kd14_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd14_ g.41.8.3 (4:) Ribosomal protein L44e {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOPe Domain Coordinates for d1kd14_:

Click to download the PDB-style file with coordinates for d1kd14_.
(The format of our PDB-style files is described here.)

Timeline for d1kd14_: