Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (364 PDB entries) Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region |
Domain d1kcrl2: 1kcr L:107-213 [72306] Other proteins in same PDB: d1kcrh1, d1kcrh2, d1kcrl1 part of anti-hepatitis B Fab pc283; complexed with ps1 peptide |
PDB Entry: 1kcr (more details), 2.9 Å
SCOPe Domain Sequences for d1kcrl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kcrl2 b.1.1.2 (L:107-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltaggasvvcflnnfypkdinvkwkidgserqngvanswtaqd sadstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1kcrl2: