Lineage for d1kama_ (1kam A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841638Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 1841667Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)
  7. 1841680Species Bacillus subtilis [TaxId:1423] [75164] (2 PDB entries)
  8. 1841681Domain d1kama_: 1kam A: [72254]

Details for d1kama_

PDB Entry: 1kam (more details), 2.1 Å

PDB Description: Structure of Bacillus subtilis Nicotinic Acid Mononucleotide Adenylyl Transferase
PDB Compounds: (A:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d1kama_:

Sequence, based on SEQRES records: (download)

>d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]}
skkigifggtfdpphnghllmanevlyqagldeiwfmpnqipphkqnedytdsfhrveml
klaiqsnpsfklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpkwykld
ellnliqfigvkrpgfhvetpypllfadvpefevsstmirerfkskkptdylipdkvkky
veenglyes

Sequence, based on observed residues (ATOM records): (download)

>d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]}
skkigifggtfdpphnghllmanevlyqagldeiwfmpnqipdsfhrvemlklaiqsnps
fklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpkwykldellnliqfi
gvkrpgfhvetpypllfadvpefevsstmirerfkskkptdylipdkvkkyveenglyes

SCOPe Domain Coordinates for d1kama_:

Click to download the PDB-style file with coordinates for d1kama_.
(The format of our PDB-style files is described here.)

Timeline for d1kama_: