Lineage for d1kagb_ (1kag B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123904Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
    automatically mapped to Pfam PF01202
  6. 2123905Protein Shikimate kinase (AroK) [52567] (4 species)
  7. 2123916Species Escherichia coli [TaxId:562] [75193] (1 PDB entry)
  8. 2123918Domain d1kagb_: 1kag B: [72250]

Details for d1kagb_

PDB Entry: 1kag (more details), 2.05 Å

PDB Description: crystal structure of the escherichia coli shikimate kinase i (arok)
PDB Compounds: (B:) Shikimate kinase I

SCOPe Domain Sequences for d1kagb_:

Sequence, based on SEQRES records: (download)

>d1kagb_ c.37.1.2 (B:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}
ekrniflvgpmgagkstigrqlaqqlnmefydsdqeiekrtgadvgwvfdlegeegfrdr
eekvineltekqgivlatgggsvksretrnrlsargvvvylettiekqlartqrdkkrpl
lhvetpprevlealanernplyeeiadvtirtddqsakvvanqiihmle

Sequence, based on observed residues (ATOM records): (download)

>d1kagb_ c.37.1.2 (B:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}
ekrniflvgpmgagkstigrqlaqqlnmefydsdqeiekrtgadvgwvfdlegeegfrdr
eekvineltekqgivlatgggsvksretrnrlsargvvvylettiekqlapprevleala
nernplyeeiadvtisakvvanqiihmle

SCOPe Domain Coordinates for d1kagb_:

Click to download the PDB-style file with coordinates for d1kagb_.
(The format of our PDB-style files is described here.)

Timeline for d1kagb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kaga_