Lineage for d1k44a_ (1k44 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027566Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1027567Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1027568Protein Nucleoside diphosphate kinase, NDK [54921] (21 species)
  7. 1027669Species Mycobacterium tuberculosis [TaxId:1773] [75438] (1 PDB entry)
  8. 1027670Domain d1k44a_: 1k44 A: [72033]

Details for d1k44a_

PDB Entry: 1k44 (more details), 2.6 Å

PDB Description: Mycobacterium tuberculosis Nucleoside Diphosphate Kinase
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1k44a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]}
tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs
llefitsgpvvaaivegtraiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsds
aesaqreialwfpga

SCOPe Domain Coordinates for d1k44a_:

Click to download the PDB-style file with coordinates for d1k44a_.
(The format of our PDB-style files is described here.)

Timeline for d1k44a_: