SCOP 1.65: Domain d1k1dh1: 1k1d H:1-52,H:385-460

Lineage for d1k1dh1 (1k1d H:1-52,H:385-460)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (2 proteins)

6. Protein D-hydantoinase [75045] (3 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [75047] (1 PDB entry)

8. Domain d1k1dh1: 1k1d H:1-52,H:385-460 [71993]
   Other proteins in same PDB: d1k1da2, d1k1db2, d1k1dc2, d1k1dd2, d1k1de2, d1k1df2, d1k1dg2, d1k1dh2
   complexed with kcx, zn

Details for d1k1dh1

PDB Entry: 1k1d, 3.01 Å

PDB Description: Crystal structure of D-hydantoinase

SCOP Domain Sequences for d1k1dh1:

Sequence; same for both SEQRES and ATOM records:

>d1k1dh1 b.92.1.3 (H:1-52,H:385-460) D-hydantoinase {Bacillus stearothermophilus}
mtkiikngtivtatdtyeahllikdgkiamigqnleekgaevidakgcyvfpXivvgsda
dlvifdpniervisaethhmavdynafegmkvtgepvsvlcrgefvvrdkqfvgkpgygq
ylkrakygt

Timeline for d1k1dh1:

• d1k1dh1 first appeared in SCOP 1.61
  
• d1k1dh1 appears in SCOP 1.63
  
• d1k1dh1 appears in SCOP 1.67
  
• d1k1dh1 appears in the current release, SCOPe 2.08