Lineage for d1jxve_ (1jxv E:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027566Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1027567Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1027568Protein Nucleoside diphosphate kinase, NDK [54921] (21 species)
  7. 1027644Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (4 PDB entries)
  8. 1027652Domain d1jxve_: 1jxv E: [71936]

Details for d1jxve_

PDB Entry: 1jxv (more details), 2.2 Å

PDB Description: Crystal Structure of Human Nucleoside Diphosphate Kinase A
PDB Compounds: (E:) Nucleoside Diphosphate Kinase A

SCOPe Domain Sequences for d1jxve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxve_ d.58.6.1 (E:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDKA [TaxId: 9606]}
certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
esaekeiglwfhpeelvdytscaqnwiye

SCOPe Domain Coordinates for d1jxve_:

Click to download the PDB-style file with coordinates for d1jxve_.
(The format of our PDB-style files is described here.)

Timeline for d1jxve_: